DPCstruct | MC41323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0028- PF10278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GKR8 | 7-90 | SLIAIIILLLYYIQSQKAELTLTPVVLWHGMGDTCCLPFSLGHIATVIKENTAGSYVHSLKIGGNLIDDYKKTYPQPLTGLVGD |
| A0A182TM71 | 1-95 | MQHTRFEVVILYFIVITTKVQVSSEKLPIVLWHGMGDTCCFPFSLGGVTKFLESEINVYVKSIEIGNSITEDFKSGYLIHPNQQVTF… |
| A0A182QYH0 | 17-101 | None |
| A0A6H5HIY2 | 11-96 | None |
| A0A507E6S2 | 2-95 | None |
| A0A7J7JVT8 | 5-94 | None |
| A0A0V0VXP8 | 550-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.