DPCstruct | MC4132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0PH42 | 1-58 | MSDSKRKEVFHIVEREGYDPIWTRVGIAFVNRDDSLNLYLDLMPMNGRLHVREPRPRK |
| A0A3A4K4N4 | 11-73 | DAASRAAPQGQPNRPWEVYTVRDKGERAFWTKIGAAFKNADGSFRVLLDALPVNGSLTILPPK |
| A0A2D5ENY6 | 7-71 | None |
| A0A3A8HSJ4 | 1-67 | None |
| A0A562P9R5 | 7-72 | None |
| A0A534TNF7 | 31-88 | None |
| Q1CY15 | 46-105 | None |
| A0A558CXA9 | 1-59 | None |
| A0A2W5TNY8 | 9-92 | None |
| A0A534YIY8 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.