DPCstruct | MC41318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 154 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316FI35 | 307-451 | SDKLTEEDIEVLIYAPVVSFCMVAMADGKVDNKEVKAFQTELAKGIVTDSELMMYIITNVISRFDSLIIDIFEAKVDLREILQQINH… |
| A0A512D2B9 | 1-140 | MSQWREQWAEQEWATLRLAPVWVLSALAGRIRFDDDERGAFWDAVTDAALRSSGPGRELLGAVAAGRVWLFDEFELDGRPVVSGLLG… |
| A0A5C6A1A5 | 28-187 | None |
| A0A2M8B9Z8 | 7-158 | None |
| A0A6N7GD70 | 5-169 | None |
| A0A7V9TWD0 | 17-191 | None |
| A0A7Y4UER2 | 15-165 | None |
| A0A7Y2JRI1 | 2-143 | None |
| A0A399Z2Z1 | 121-275 | None |
| A0A5C6EB88 | 116-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.