DPCstruct | MC41314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4159 |
|---|---|
| Mean domain length (aa) | 306 ± 55 aa |
| Standard deviation of domain lengths | 55.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.31 |
| Mean intra-cluster sequence similarity (%) | 11.60 |
| Pfam Score | 96.62 |
| Assigned Pfam label(s) | PF16153- CL0094- CL0268- PF07595- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q12Z43 | 12-274 | TVDDDGFAKFMSIDEAVKYSKTGDTIIVYPGTYFENVDVYKEITLVSYSGDPNDTIIQTLGPDAHVLHVTEDNVTISGFTIIGASTS… |
| A0A496LZT7 | 3-347 | YGAIGDGVNDDRQAIQDTIDAAAKGLGGGNVYFPEGTYLVKEIVFLKSHTHLELNEKATILNGINIKNHPSIVFMTGLFTDDGAQVE… |
| A0A1F6ZMG3 | 624-903 | None |
| A0A1F6ZEN5 | 607-895 | None |
| A0A5C8NKX0 | 236-556 | None |
| A0A7Y0PD20 | 25-374 | None |
| A0A376ENF1 | 2-275 | None |
| A0A357ZF29 | 74-356 | None |
| A0A4V1KPB3 | 65-439 | None |
| A0A3R6N932 | 60-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.