DPCstruct | MC41313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 93 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q12YZ6 | 148-239 | MTDNESTKEDMHAWTAKYADKAGYMLNPDEESLHLVLEGLARNRNKHGKNYCPCRIVTGDEQEDKKIICPCIYHKDEINDGGSCHCD… |
| A0A497QSM3 | 4-94 | KEQTRKFMEMVAKKNGWHLNRDEEFLDMLADGLTTNYNRYGYYSCPCRDADGDKELDKDIICPCDYCVPDQKEYGHCYCGLYLTPEF… |
| A0A7C4HGW1 | 13-109 | None |
| A0A522V718 | 3-88 | None |
| A0A7J9LF87 | 3-136 | None |
| A0A7J0EA49 | 35-114 | None |
| A0A7N0T286 | 2-91 | None |
| A0A7J7M754 | 34-130 | None |
| A0A2T1EU81 | 6-110 | None |
| W0EHB2 | 19-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.