DPCstruct | MC41309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1A1X6 | 4-81 | QDENSLSRQTRASSLAKESKSDFLALVGDMNNEKYPIYMTGPLLYTLCTAVIDLDEKILTIIEGNPKEKQESYVFSLS |
| A0A1Y1L8Q2 | 118-193 | RDSSDARLRVLNEYPKALKKSDVIKMLSDQTDSRYTVFQETNIQTIAVGIFDCREKTWSIYSDKANQNEPLIVLPL |
| A0A7S1W9L4 | 3-102 | None |
| A0A287KL75 | 170-246 | None |
| A0A836B4Y9 | 573-662 | None |
| A0A453EGE8 | 3-73 | None |
| A0A453EGB4 | 117-195 | None |
| A0A814L0I1 | 131-210 | None |
| A0A6J1BZ81 | 206-300 | None |
| A0A820N1F4 | 7-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.