DPCstruct | MC41307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0ZWM3 | 1-88 | MELAKLCADKNIPVVPIPGPSAVVTALSASGLPTNEFSFVGFLPKHNSSRKERLILSANESATQIFFIPPHKLSQFLEEAAAIFGESR |
| A0A7W0RQG8 | 88-179 | PGISDPGYRLIRACVEQRIVIVPVPGPSAFVAALAASGLPTDEFYFGGFLPARSTARRARLAQLRGLAATLIFYEAPHRIAGALADA… |
| A0A0R0K914 | 33-126 | None |
| A0A1S3E7W2 | 143-235 | None |
| A0A6P0R3V8 | 90-182 | None |
| A0A4S4EMC1 | 92-183 | None |
| A0A4S4EXM5 | 21-103 | None |
| A0A1C5MY15 | 87-178 | None |
| A0A4S4D2A1 | 71-162 | None |
| A0A4S4DKZ5 | 170-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.