DPCstruct | MC41302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5LP50 | 22-80 | MPVEDYVAQPFVRENELFNFLTKMCLLKLDGRYNGFSSILTATSSFKKSYLYFNNKDAS |
| M0ZQG5 | 1-70 | MQWMPLVEFVEQPLIQEDDMFKKIIDIFIARLGKRYCGLSAHQLVSKFDDKLSTLYFNTVDDPNLNCQAS |
| A0A4Y1RDV0 | 124-180 | None |
| A0A2I0W6H7 | 1-54 | None |
| A0A426Z431 | 107-168 | None |
| A0A834ZQ13 | 105-165 | None |
| A0A072TG21 | 1-68 | None |
| A0A5N5KAK1 | 37-112 | None |
| I3SLH8 | 42-111 | None |
| A0A1R3IMC5 | 222-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.