DPCstruct | MC41300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151RS72 | 42-160 | QEIYYNFLNYVKLNIPFLDWFHAYTIKKNIDYPFRDDLIGQHSTNVIWHLKDGEKVQSELPPKTQYQFPQIRDEKNNLVLAAPFKTK… |
| M0ZNU1 | 1-121 | MADMRRISCEIEFFKWFEMTCKIDNQIESLQVIINKWYTTSNKVVESITPPLEGINIPIAGTVIKASPFKEKSDKSAAFVTSADIDR… |
| A0A151S9A7 | 85-192 | None |
| A0A151S2K0 | 7-166 | None |
| A0A151SX61 | 57-164 | None |
| A0A2K2CB02 | 219-399 | None |
| A0A2K2C021 | 1-120 | None |
| A0A837A447 | 125-268 | None |
| A0A5D3CX84 | 1-149 | None |
| A0A0R0IHU5 | 172-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.