DPCstruct | MC413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0L850 | 1-107 | MNTRIHYLYRDGANNKQGGQEVLAGLLSDEQITAIRQACDENTWFLAGAVGLPDLQLKWKEKGYPFPTDNDHVWSELESIEATNDAP… |
| A0A177IG09 | 10-130 | AGDGPNTRITWTYTDGGNHKHSRRSVYAGAISGEQAALLASKLTADGEFVPADVGMPMLQLAANCFWHPTLDHAWHTLDAIETSRET… |
| A0A7C9GEJ5 | 3-101 | None |
| A0A1Z9X281 | 6-113 | None |
| A0A0B4Y707 | 201-312 | None |
| A0A2P8DQ10 | 87-161 | None |
| A0A2A4UCP5 | 18-118 | None |
| A0A1Q8G2Z5 | 149-276 | None |
| A0A6C0RBC6 | 1-84 | None |
| A0A415U1G0 | 147-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.