DPCstruct | MC41298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 13.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9ANN6 | 321-442 | VEIPKDRLRSWEDHYKTYRSEMTEAMQLAGDSKKETAGDVIHKYKQILYGADDLHKSSRPWEEIRLDALALYHVTYDYAIKQGQAKY… |
| M0ZHN4 | 2-135 | GVYNTIIVVQSSPTPFLLPLPRFFDVIDFLNPKATMSLHFSPLIFQIFMQLLYEAPDMEESIRSTTDMYNDALAIYCVTYDYAKAIG… |
| A0A287KII0 | 84-237 | None |
| A0A6P6SD87 | 26-183 | None |
| A0A7C9APX0 | 89-221 | None |
| I1HCZ7 | 1-151 | None |
| A0A287KIL4 | 1-154 | None |
| A0A2P5B8Q3 | 468-602 | None |
| A0A835IAH2 | 872-1000 | None |
| J3KXC3 | 702-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.