DPCstruct | MC4129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 168 ± 19 aa |
| Standard deviation of domain lengths | 19.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1R705 | 1-135 | MALATLVDEMGVMYAVHPKILYAVADEAKATMLYTAMDDAGNVFLLPVGLPGSDGSTNAWWQSGHAAAAIAQKEWVRIVAVKTAGHY… |
| A0A3A4JTW5 | 41-219 | PNPQEIPQPISQDYRKLLTTLVFGIPIEIRSPRPQEFFRRRPDPSYSTTMPLIQLREEKKYYLVDKTLHENLKLDLQLFDLVTCINH… |
| A0A1C2IYH0 | 133-314 | None |
| A0A7U4ZB96 | 3-187 | None |
| A0A6A7Z914 | 9-169 | None |
| A0A3D2ICJ5 | 21-214 | None |
| A0A5F0K7E9 | 25-166 | None |
| A0A7U5KD41 | 12-180 | None |
| M5U9W9 | 149-321 | None |
| A0A4P5WXI7 | 4-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.