DPCstruct | MC41288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 52 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1YZK4 | 2-55 | AVLLALLSLGVKGIRLGPTLPGFLSANVAKVLVDNFNIKPIGAVQEDIAAMMAG |
| A0A7X6WJI9 | 125-171 | LHLGIKNIRLGPSLPAFLTPNVLKVLQENYNLQPITTPAEDLKVILG |
| G5S9C3 | 29-82 | None |
| A0A7C6UVE3 | 1-40 | None |
| A0A7X8Z9M6 | 13-66 | None |
| A0A644YZ20 | 275-340 | None |
| A0A842UKQ3 | 2-47 | None |
| A0A7C5DXS5 | 2-47 | None |
| A0A354KQI5 | 4-48 | None |
| A0A7J7Q110 | 826-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.