DPCstruct | MC41285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 14.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 58.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1E974 | 144-322 | KPARYDTLWELTCHYQIALAGANPVARKKSPQISLKQFSCYLFKNLEKTGEAICELKPLARSEIVKLIKKCDARSYTIASAQDRFCT… |
| A0A5P1E6J1 | 31-177 | MPDRYETLWDLTCHCHIALAQFEPLAKMTKSNVSLKQFASYLFRNLESNSSEAICELAPLTPSGVNSLLKKIDAHSYTISSPESGFP… |
| A0A5P1F4Y0 | 530-716 | None |
| Q2XNV6 | 72-246 | None |
| Q2AA21 | 230-401 | None |
| A0A5P1FRH0 | 116-268 | None |
| A0A5P1EFA1 | 1-187 | None |
| A0A5P1E739 | 285-437 | None |
| A0A5P1E6B6 | 326-493 | None |
| A0A5P1E5R9 | 277-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.