DPCstruct | MC41282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 490 |
|---|---|
| Mean domain length (aa) | 308 ± 58 aa |
| Standard deviation of domain lengths | 58.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.81 |
| Pfam Score | 79.50 |
| Assigned Pfam label(s) | CL0023- PF13195- CL0236- PF20073- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1FA92 | 52-319 | IPDVIMEGLSRKNYAEFFSTLLAVEEIHLEEEMRTHDMELVTMKRRGNHFLSLEVPGLAEKRPSLVYGDYIFAKLVVPYSNDNKTYQ… |
| A0A1G9IIB1 | 33-365 | LPEDREQWTDDHYLWELVFQLLDFHRRADKPVWWAMFARQEMTEEELIDDPECIGGMEAAPEHPPEAVKQSSVYTFRYPEQEFKLKV… |
| A0A7R9P053 | 354-655 | None |
| A0A6I8V255 | 640-1014 | None |
| A0A2B4SB46 | 337-657 | None |
| E9FRA5 | 206-601 | None |
| A0A4Q7WG60 | 1-201 | None |
| A0A370PGA2 | 29-384 | None |
| H3B0T4 | 432-756 | None |
| A0A446PGS0 | 186-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.