DPCstruct | MC41277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5LQR4 | 1-66 | MLIGIAEEMLKQENVESVLFGGKRISEQRNFEKLDWFAGELVQEHQRRSCRIAPTVAFKQATPKGT |
| A0A5P1F0Q1 | 9-85 | SNYVRIQANAEDMLSHRNIESVLFRGKKISEQSDADKLETFAEQLIKEQQRRKSSSIPTVFIKQAAMTPRSSSATIS |
| A0A0D3GM71 | 220-324 | None |
| A0A445MG63 | 9-99 | None |
| A0A6J1CDM2 | 16-110 | None |
| M7YNC9 | 1-72 | None |
| A0A811MR65 | 43-125 | None |
| A0A287XPD8 | 121-243 | None |
| A0A6A6MYJ8 | 175-244 | None |
| J3MIJ0 | 99-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.