DPCstruct | MC41273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3D5N4 | 64-146 | IGFVGVATDEGKVALVRRDILIAWRGTLTQSEWNDDKQVPFVQPTEIFRENTNNILVHKGFYSIYTSLNPASDFNRTTSARDQ |
| A0A5P1ETP3 | 1-94 | MGFVAVATDAGAEAMGRREVVIVWRGTLQALEWVNDLEFILVSGEKFFGDGDEKVHRGWLSIYTSEDAKSLFNKTSARDQGSRGGFK… |
| A0A6A4PNR4 | 1-116 | None |
| A0A1B6QC36 | 31-122 | None |
| A0A6P3ZMW9 | 10-96 | None |
| M1D4F5 | 111-196 | None |
| A0A2Z6M737 | 1-93 | None |
| A0A4S4EFV4 | 2-83 | None |
| A0A3L6R8Y6 | 160-256 | None |
| A0A446PUB6 | 510-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.