DPCstruct | MC4127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A246JWU5 | 41-115 | AIDIHVAHIDHREGVNLYAAVSRETLMREIAEFCREYWSEIAHDRDPDTLDDEDIARIYFELHPDEYLQTDRVAI |
| A0A1H8PND8 | 8-87 | IYGFLMTDTIYIAVYRHRHGEDIYAYATEAAALKARDDLANEQWKCEIEGKREPKQKIGERYFGLVEDEKFEIPKRVVLA |
| A0A7I7SBX6 | 2-82 | None |
| A0A2D8QZY4 | 137-238 | None |
| A0A3L7T967 | 15-104 | None |
| A0A418L5I3 | 93-182 | None |
| A0A5B9YV61 | 33-115 | None |
| A0A495QWZ0 | 52-148 | None |
| A0A0J6T4Z8 | 104-190 | None |
| A0A4P6FXS4 | 174-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.