DPCstruct | MC41268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18907 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8Q5M7 | 2-147 | KYVRYLILILKHKYFVFVEGMRLHVPIARLIKHDMSKFRPSEFFVFAERFEGQGKGLPEEALPPRLRKRFADAVDLHHSRNDHHWNY… |
| K8ZB89 | 4-161 | TLWNHLKTITHHRHLVMKNCFRCGLYKRGLLHDLSKYSPQELYVHRYWTGTHSPIHQDKVEHGGCSKAWLHHKGHNAHHLEYWLDNS… |
| A0A0G1X8Z6 | 2-146 | None |
| A0A0S8G1D7 | 3-132 | None |
| A0A6L5X848 | 2-165 | None |
| A0A7C3YXE2 | 393-570 | None |
| A0A1I6IRA4 | 8-188 | None |
| A0A174QEN1 | 6-169 | None |
| A0A0D6KUD9 | 1-170 | None |
| A0A1M5WM19 | 57-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.