DPCstruct | MC41267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 211 ± 51 aa |
| Standard deviation of domain lengths | 51.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.63 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | PF02618- CL0376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6X3E5 | 1-131 | TWMYTANTTDVALLKRAHQKMVKAVDTVWEGRADGLPYQDKNQLVTMASIIEKETAVASERDQVASVFINRLRIGMRLQTDPTVIYG… |
| A0A2E8NMQ6 | 89-323 | FTPKQLISMFALGKVKLYDFRINEGWTYSDLESALSSNPNVTFTLNLYSYQQNVRRLGVGYTFLEGVFFPDTYSFEKGTKDIEILKR… |
| A0A1R3UK73 | 462-744 | None |
| A0A7T5RK43 | 302-551 | None |
| T0CRF2 | 2-154 | None |
| A0A7X3VLI3 | 14-184 | None |
| A0A482ZAS4 | 361-600 | None |
| A0A3A4VHT2 | 323-585 | None |
| A0A7V7B1B3 | 72-317 | None |
| A0A1E3WAZ3 | 25-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.