DPCstruct | MC41262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F3RG69 | 153-282 | DGDGGNGQDKQDDQQDHEQKDDGQEENKKPKRSTEEEALLQCLQYEQKYMCLMRKNDGKGSSPLADEDLPQQIDEADQFSPDSWIPR… |
| A0A2I0WJ32 | 1-123 | MAAFVGRRHSSPFSTSLSPLTTSPSNSHPLSSSSDDDDDEVEDDDRSNYYTPMPEPASIDPRDSNTSDNWIPRHPSLIRLTGKHPFN… |
| X0AKW5 | 146-294 | None |
| J4GPU7 | 481-598 | None |
| I8A9Q0 | 129-264 | None |
| G2R5E5 | 1-120 | None |
| F2PM84 | 126-243 | None |
| A0A199W8M5 | 1-130 | None |
| A0A835CXK9 | 9-128 | None |
| A0A383WE65 | 5-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.