DPCstruct | MC4126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 392 ± 72 aa |
| Standard deviation of domain lengths | 71.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1Z0Y6 | 2-359 | AYQKKLYAEFSKARSIKNNQIKKAKKMQATKANIQKLAVMARNPQFVYLRSREKKNHEITLKNYGIKLADKIVGDAIKKFNSFPATL… |
| A0A5J6N2D5 | 373-690 | LAAKGAWIDTADPQIAQARTAIKAYSAGLEALAAVETRIAALPDTSDSLPQLYQLANDPAQQSVDQARRQSFQAAVAAKQKAINARA… |
| A0A1Z9X2N7 | 140-597 | None |
| A0A6M8W672 | 20-444 | None |
| A0A7S7UW28 | 33-420 | None |
| A0A7V7MUX4 | 1-562 | None |
| A0A447ILK6 | 120-552 | None |
| A0A847DS57 | 3-397 | None |
| A0A6M8W3M0 | 1-380 | None |
| A0A163XCD3 | 22-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.