DPCstruct | MC41247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 223 ± 43 aa |
| Standard deviation of domain lengths | 42.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 87.43 |
| Assigned Pfam label(s) | PF09324- PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0JF39 | 19-238 | HPPSTSPMEALSLKLTAEPSVNESIGETSSQSVVVAVDRIFTGSTRLDGDAIVDFVTALCQVSMDELNSPHHHPRMFSLQKIVEISY… |
| A0A2Z5U7K7 | 2-165 | LSRVFEASKNLDDVALHHLIDALCKLSNEAMDLAYSNREPSLFAVAKLLETGLANMHRIEVMWRPITNHLLEVCQHPHIRMREWGVE… |
| A0A044RGB2 | 812-1127 | None |
| Q6GP04 | 739-949 | None |
| A0A061R7E5 | 84-305 | None |
| A0A7S3ZQP3 | 243-551 | None |
| A0A4Z2HQV3 | 8-194 | None |
| A0A6J0PET4 | 496-762 | None |
| X6NP62 | 436-650 | None |
| A0A446M4K8 | 34-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.