DPCstruct | MC41246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8WKD8 | 58-130 | EVIGHPCCIGIHGACQITTQEYCEFLNGFFHKEAFLCAQVSCMNDVCGMVPFYSADTPDQFYRLWTSLFLHAG |
| H9JCN1 | 212-283 | VIGHPCCIGVHGQCVFTTNDHCDFVKGYFNEEASLCSQVSCLDDVCGMLPFMRRRRPDQLYRAWTSLFVHAG |
| A0A5J4N5K2 | 182-252 | None |
| E9IIC4 | 91-163 | None |
| A0A267FK24 | 363-429 | None |
| A0A267GA62 | 360-432 | None |
| A0A3P8B093 | 348-418 | None |
| A0A6P5W1K9 | 68-161 | None |
| A0A0N4VVT9 | 4-76 | None |
| T1FX99 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.