DPCstruct | MC41240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 206 ± 39 aa |
| Standard deviation of domain lengths | 38.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J3H6 | 14-192 | WVNVTSDFFESIKYLELGELLHDEFFGLFEAMSAIEMMDPKMDAGMVCNRGNNSVMNFDKAVATGVIDIKDIPFDVQIGVIDETYSC… |
| S2J038 | 32-243 | QWKDITSFLDEATNEFDVGQLVHLQSFTLFDAMSAIEIMDPRMDTGMAIEHTFESFDIEKRTSPEDTLGIMDRLVVREMAWISGHSL… |
| A0A5K4EFD3 | 1-220 | None |
| A0A6V7U7M1 | 5-205 | None |
| A0A0F7SL68 | 5-215 | None |
| A0A1R0H185 | 1-284 | None |
| R1D6J8 | 30-192 | None |
| A0A397D169 | 1-165 | None |
| A0A164VAC3 | 11-192 | None |
| A0A4T0LNV2 | 24-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.