DPCstruct | MC4124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 117 ± 22 aa |
| Standard deviation of domain lengths | 22.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497PK16 | 22-135 | KTKNITEKQKKRMMKTFGTRFEKAYQTILDRKVKKYIFKPSEKQVWIVIGKGNIYQILPSVNFCSCNDFYFRVIGQEIFLCKHLIAQ… |
| A0A0D7BU89 | 12-131 | SIQMDNFHETIPLLQSIIPEALLLASLDILDRHNVNVYEAPSGYVSYEVTGSESISTVSLGLKNSPIRDFCSCKSYIYAVLSEETHL… |
| A0A816R381 | 11-143 | None |
| A0A847V8K7 | 10-101 | None |
| A0A4Y2CLM4 | 2-108 | None |
| A0A7N0TMY6 | 11-120 | None |
| A0A287HP64 | 24-124 | None |
| Q16V40 | 45-180 | None |
| A0A553MS47 | 40-167 | None |
| Q5CPY5 | 17-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.