DPCstruct | MC41238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.70 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0229- PF21054 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RBD9 | 43-147 | KKVAVTKQNYRCAGCGIRIEPDYIKRLRYCEYLGKYFCQCCHENAQSVIPGRILRKWDFSKYYVSNFSKDLLTKIWSDPLFNLHDIN… |
| A0A183DA57 | 36-143 | AILTTISREKGLDAQDFRCPSCRKSVGPTFASYRKCGFDEKYYCDGCLSKGEEIVIPARLIHNWDARPRPVCRRNMAFIERIRDKAV… |
| T1FZW2 | 36-178 | None |
| A0A183J6K5 | 97-183 | None |
| A0A183NSY3 | 88-189 | None |
| A0A3P6RD78 | 102-228 | None |
| A0A3P9KBQ6 | 570-729 | None |
| A0A1Y1NGI9 | 4-94 | None |
| A0A6P5GBX3 | 467-583 | None |
| A0A6P8HJD2 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.