DPCstruct | MC41237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 66.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C0F3 | 1-172 | MLNLQTTPPKPGTPPSPTAPRAELVLPLRHASVDYCMQMHTRRYTKSLLITVGRDQYLIQDESEANAATWLYHIKQIIYKMGPPAPD… |
| A0A0S7HEY4 | 101-246 | KFGSNQSKPEFMVDLRGASVEWASKEKSSKKHVIELKTRQGMELLIQSEIDSVINDWYRALTETINTHAWESDEAIEEDMPESPGAE… |
| G3PPK0 | 460-604 | None |
| A0A2G9SJ30 | 1-138 | None |
| A0A6A4JRC0 | 242-395 | None |
| A0A553RDG5 | 331-487 | None |
| S7NAP5 | 135-277 | None |
| A0A3B3UJP6 | 263-406 | None |
| A0A401NWS2 | 356-509 | None |
| A0A3Q4GPT7 | 189-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.