DPCstruct | MC41235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 243 ± 20 aa |
| Standard deviation of domain lengths | 19.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF10493- PF10245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J0H4 | 10-252 | RACYILQRDNEFASFLLSRAFPDTDSQPTSVRLRALQCLFAIKSYDSLVQMTGRGDLKYYLEDLHFVMELENLGFSYTMEEFQSWSK… |
| A0A7J7S1L4 | 3-239 | QLTFAHRTRALQCLLYLADKETIESLFKKPIEEVKSYLKCITFLASFEMLNIPITYELFCNSPKEGMIKGLWKNHSHESMAVRLVTE… |
| S4R4E1 | 700-940 | None |
| A0A6G0XV54 | 855-1104 | None |
| A0A4W3HU79 | 692-966 | None |
| A0A194RL02 | 530-778 | None |
| A0A146LH57 | 132-372 | None |
| A0A1A8M8V5 | 563-798 | None |
| A0A653BP64 | 214-459 | None |
| A0A821Z1B7 | 268-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.