DPCstruct | MC41233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0IZR7 | 1-70 | TSPCFSFRRYDWFKELGLRWYAVPAVSGMMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEVSL |
| A0A3D4CZ38 | 178-255 | VVRELPPAAVLEVELAHPDHEWFEKLGLKWYALPTLSDMLLATGRELYPCAPFNGWYMGTEIGARNLGDDSRYNLLPV |
| A0A6F9A9T5 | 223-305 | None |
| A0A6P4EAF3 | 18-78 | None |
| A0A640VP22 | 30-104 | None |
| A0A402CJ30 | 77-152 | None |
| A0A1T3NPD6 | 206-281 | None |
| A0A444TM15 | 137-218 | None |
| A0A3R7P879 | 1-82 | None |
| A0A822I0W1 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.