DPCstruct | MC41230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.92 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0163- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8D7M0 | 27-103 | CYPFYKTDPFILLECPHVYFCGSAPRFGSKVIRGPEGQTVLLVAVPDFSATQTACLVNLRHLACQPISFSGFGAEDD |
| A0A3Q0IVP3 | 1-66 | MIIESCPDVYFTGNQSKFETKTIEIEKDKNVRLISVPDFFSSRTVAILNLSTLECHSLVVEDLTEE |
| A0A168BS01 | 26-114 | None |
| K5W932 | 422-506 | None |
| I1CM34 | 434-506 | None |
| A0A0C2JGQ4 | 166-229 | None |
| A0A183J9J4 | 178-242 | None |
| A0A7S0XA18 | 43-109 | None |
| W6NA21 | 26-91 | None |
| M3Z3C9 | 243-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.