DPCstruct | MC41227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821KTI8 | 551-621 | YMAESETKPTLTELNPPPDYVSQRIKIWEELKTKYQNYVASQPQVDITITLPDGKKLPGKSWKTTPNEIAQ |
| A0A183KTN8 | 47-124 | ASLEASNHQCGLAVALNEKSLPPPPEFIKHREELWNKLKREYDGFVASQPRSPVQITLPDGTIVDGKAWETTPMEVAK |
| A0A4S2LWC2 | 18-105 | None |
| A0A5K3G092 | 16-103 | None |
| A0A3Q1GS37 | 4-90 | None |
| A0A402G0Q7 | 12-88 | None |
| A0A182MZ47 | 5-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.