DPCstruct | MC41223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 40.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0INQ1 | 1-116 | MDSFVLAETFKYLYLLFSEEEDLPLNLNHFIFTTEAHLLPLSLTLYNFTHHHVDNFDMDLDSDEELTRQCPSTLGLFPHSVREPMKN… |
| A0A182EQJ9 | 1-135 | MDSFVLSETLKYLYMIFTDPSDLQIDLDNYVLTTEAHFIPLSIADTDNSEKLPRRLIIDPDEIIDDENAMIAKKFRSACPTVINEKH… |
| A0A026WQU7 | 306-412 | None |
| A0A194QWF5 | 80-183 | None |
| A0A146L139 | 1-111 | None |
| A0A2K6G7S8 | 267-391 | None |
| A0A0N4TG01 | 46-172 | None |
| A0A5E4NFR2 | 227-323 | None |
| B0WI43 | 36-142 | None |
| A0A0L8GVJ8 | 85-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.