DPCstruct | MC41222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 248 ± 62 aa |
| Standard deviation of domain lengths | 61.51 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 73.37 |
| Assigned Pfam label(s) | CL0486- CL0077- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0ILS3 | 12-300 | PICSMHGLAVTTVEGIGSTKTKLHPVQERLAKAHGSQCGFCTPGIVMSMYALLRSLPGKPTMKDMEVALQGNLCRCTGYRPILEGFK… |
| A0A3M5JR43 | 33-310 | PGTKEGCASGDCGACTVVVGELHSDADGKQTLRYRSLNSCLTFMASLHGKQLISVEDLKHQGQLHSVQQAMVECHGSQCGFCTPGFV… |
| A0A812ZMB1 | 283-619 | None |
| A0A653C4B2 | 133-330 | None |
| A0A2A2KP58 | 63-317 | None |
| A0A1R1SAK1 | 59-222 | None |
| A0A388LDW1 | 2-416 | None |
| A0A7R9B0P5 | 293-608 | None |
| A0A356KVE4 | 19-201 | None |
| A0A446M8Y5 | 5-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.