DPCstruct | MC41220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 292 ± 40 aa |
| Standard deviation of domain lengths | 40.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6A7U5 | 1-328 | MLLKSVHNLKFNLFILLALFLFSVFFWLTFPVRAQESDAISIRVHANREHKSALIWYQEEFADREEQGAPQSLRVDGYNAVRDGRTV… |
| A0A2M6WT45 | 23-301 | AHAVDDNPLDALAIRVMPNLYHLSPLTWYKKNVDTPGSLQSVVVDGYSGVRDGRTVYISAANIDNSNLYTNIYIISYNQESESATTD… |
| A0A7T9QC18 | 7-343 | None |
| A0A351SM89 | 13-315 | None |
| A0A1F5SHP8 | 8-272 | None |
| A0A2N1UMZ9 | 35-330 | None |
| A0A0G1RWS6 | 182-448 | None |
| A0A7V4IJH7 | 1-364 | None |
| A0A1V5R693 | 1-255 | None |
| A0A0G2ASB5 | 77-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.