DPCstruct | MC4121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02599 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353XY15 | 1-43 | MLILTRRNGETIRIGDDIEVAVLAVTGNQVRIGIDAPLRTTLV |
| A0A0B2AI45 | 1-60 | MLVLTRKPGEKIMIGDEIVITFLESRGSEGIRIGIDAPRHLAIKREEIFEAVADANREAA |
| A0A7V8QHK8 | 9-96 | None |
| N1ZMT4 | 1-65 | None |
| A0A4V0HWC0 | 21-99 | None |
| A0A7S9L954 | 1-59 | None |
| A0A5B9PAX9 | 1-65 | None |
| A0A2E3REY3 | 27-92 | None |
| I2CAR2 | 1-50 | None |
| A0A7G1QA81 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.