DPCstruct | MC41203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U5D1E7 | 1-84 | MQKELIGFETLDLSAPGLPPKLKLYMEAEPLLLGKDSRMGIREMVSAVGHACVNSIDLLSQYINYKPGHQCPDDWDIAQKLMLR |
| G7JBU5 | 63-142 | LLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSMGYSCEKSSDLMSQYMNYKVFGNCQDDWSYAQKLILK |
| A0A804R2L7 | 48-154 | None |
| A0A2R6RJ60 | 53-136 | None |
| A0A5C7ID23 | 139-207 | None |
| A0A835S7F2 | 124-191 | None |
| A0A2R6PX16 | 1-84 | None |
| W1P340 | 92-170 | None |
| A0A7J0DI92 | 1-83 | None |
| B7FJ91 | 97-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.