DPCstruct | MC41200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444DLY8 | 158-272 | TLKLVAIVAILVAGVVGVAIPLAGRKRRLLRTDGGVFVCAKAFAAGVILATGFVHMLHDAQSALTSPCLPTSPWRRFPFPGFVAMAA… |
| A0A022QFP9 | 45-159 | PLKIIAIVTILISSIMGVCLPLVTQSIPALSPERSLFVIVKAFASGIILATGFMHVLPDSFDMLSSTCLKENPWHKFPFTGFVAMLS… |
| A0A452Y6N5 | 110-210 | None |
| A0A453SNT8 | 78-195 | None |
| A0A452Y6N9 | 1-101 | None |
| A0A5P1FVU6 | 51-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.