DPCstruct | MC4120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 450 ± 95 aa |
| Standard deviation of domain lengths | 95.15 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A158F8F9 | 284-552 | KSMPRKNRGTGGLDADLILTFQPGGWGIAASILLRRPEGMPEQVAIRVGSETISLVAIDDEFFEPLPLSNISAALQDGIVVKTADAV… |
| A0A0B2AH18 | 8-442 | AGDSLGSSVRSLLNLRGSHRATFANFDQMTTQWARRRRKAVREGERTPLPPVIGLLMIFSMAAERMGARDPGTVKTEAGYYAQLERL… |
| A0A6L7PVX3 | 1-396 | None |
| A0A2D5VJK3 | 339-847 | None |
| A0A380CVD7 | 1-382 | None |
| A0A4T0V044 | 12-567 | None |
| A0A358IRZ6 | 18-435 | None |
| A0A178LZV0 | 159-633 | None |
| A0A4Q3TL84 | 5-441 | None |
| A0A1U7CWD7 | 4-559 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.