DPCstruct | MC412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7KQV6 | 283-362 | YRRQRKADMAFEDYDFGANIVEDMSGWEYVNDAREMIRLVFFENRADPDQDSLKGSFTVLFEKNSDEIASVSADIDGYVF |
| A0A177ID56 | 18-102 | ESRHVAADAKFEAFDFGSSNVVEDAEGWEYFNDGDEMTRTVYFENAENPEADSQRGHFTVRFEEGTDAIAEAYGTLGGAILDDLR |
| A0A6P1Q7V2 | 18-97 | None |
| A0A1I7KCD4 | 88-175 | None |
| A0A2D8QZX6 | 213-325 | None |
| A0A0E3BG33 | 223-321 | None |
| A0A1C7LKK5 | 4-91 | None |
| A0A250LLF1 | 89-191 | None |
| A0A4Q2VE83 | 2-87 | None |
| A2SN63 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.