DPCstruct | MC41197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 77.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9TXD7 | 25-104 | MHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGAITNPSIWSYEGVAGAHIVFS |
| A0A445CEJ7 | 14-74 | ALYELAVFDPSDPVLDPMWRQGMFVIPFMTHLGITNLWGGWSITGGTTPNPIWSYEGVAGA |
| A0A814RG48 | 38-102 | None |
| A0A452XDL7 | 1-80 | None |
| A0A2J6K653 | 14-63 | None |
| A0A7J7LK22 | 1-67 | None |
| A0A0X8WVE5 | 38-106 | None |
| A0A830C9B3 | 1-65 | None |
| A0A7J9KFN6 | 1-53 | None |
| A0A835MXR9 | 12-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.