DPCstruct | MC41190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3RY68 | 19-129 | PLRRAFLAELVRSDLRPGTATKKMVAFDTTGGERLVWQVEATAQNFFLHRKWSDRVEAAGFVVKLFLYQNGQKDGARHSGLSRDWSF… |
| A0A8A3KKZ1 | 1-125 | MTQDMQFKKQVEKLLDQVGREHRAKHQGVYASRYVIHVTGGVPFEVMYEKGTKTPPNIWCLAKVTDHVEGVDCEIDRADRLNREPGQ… |
| A0A0B9G8W6 | 218-335 | None |
| A0A6H2KZW5 | 1-131 | None |
| A0A1M5BA96 | 404-534 | None |
| A0A3D3ZPM6 | 1-120 | None |
| A0A285M596 | 229-344 | None |
| A0A7T9B1R2 | 3-116 | None |
| A0A061JM86 | 205-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.