DPCstruct | MC4119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 166 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2M773 | 1-161 | MVSVYMPDDGCLWVMDPYYALAPEKTTQITQYGDLTNQELISESGQQTNHLSKIIDTGPQTTWCYYFEKGDLAQSKGKYDEAVNYYE… |
| A0A350M2J9 | 24-182 | ILVMTQPSVNSCVHVINGMQSEYSPGEWDLIREVGPYSEIEHILVNETPHTPPTVVFGPEPAHGWCYYYQKADLARQRGEWEKVLEI… |
| A0A7Y5F3D9 | 235-404 | None |
| A0A7W0FFM5 | 319-486 | None |
| A0A523XM32 | 349-506 | None |
| A0A136KZS7 | 1-150 | None |
| A0A1F8PZB6 | 74-238 | None |
| A0A524PHK8 | 88-266 | None |
| A0A3D0RST0 | 67-226 | None |
| A0A7X9JA79 | 118-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.