DPCstruct | MC41188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 14.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243HDL0 | 124-228 | KYTYEFYRDGLGGLRIRLPKEISIISHFLEDILDDEADEYIQILDKVVDQKVPQYEIEGNVAAVYIEPNYTSAINLFMSAPNNQCKI… |
| A0A315EM01 | 3-131 | LRCFIQTQAPIPGSGAQPVRYPACEWVDDDGAADPQHPLNRFVCSWLTSDVNTVERCQEVLDAIAQIEAGQRTQWFADGDAFGVDFS… |
| A3D0Q3 | 73-191 | None |
| A0A2T6ERF6 | 4-93 | None |
| A0A2G6PK17 | 1-124 | None |
| G6F245 | 2-118 | None |
| A0A3N1PFL4 | 1-114 | None |
| A0A1M4UCJ4 | 3-128 | None |
| A0A1E5KZ49 | 3-120 | None |
| A0A2T6A491 | 5-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.