DPCstruct | MC41185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 41 ± 3 aa |
| Standard deviation of domain lengths | 2.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7JEE0 | 1-36 | MDSFDYIIVGAGSAGCVLANRLSENPANRVCLIEAG |
| A0A100IDT7 | 1-43 | MSPVAEFDFIIVGAGSAGCLLANRLSANPDHRVLLIEAGGKDN |
| A0A7R9KD13 | 590-632 | None |
| A0A226F2H1 | 51-93 | None |
| J9L387 | 49-89 | None |
| A0A484AU50 | 88-131 | None |
| A0A4R6Y806 | 1-40 | None |
| A0A851HP24 | 1-38 | None |
| A0A221K791 | 5-46 | None |
| A0A817G3C4 | 33-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.