DPCstruct | MC41184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 350 ± 100 aa |
| Standard deviation of domain lengths | 99.76 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.23 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF20916- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A100IB51 | 10-340 | LPGDTTTLRELGQPGLNSVGLQPRVTIGLDQTRFARSVHSMRVHLQGSYSPIPPSMAGQIVATIGAETIDRWPTESSGVIDRWVDVP… |
| A0A2N9AVE3 | 122-363 | GFRLSGEEDVLQYPVYLTEGQARGAARLRVSYLSAISVAPEGSELTGLVNGTKVGWTRIQAPGAVKVVEFAIPDGVLKAGYNAVTLT… |
| A0A3C2ACD4 | 49-403 | None |
| A0A6G7GP74 | 4-453 | None |
| A0A3M3VL32 | 101-494 | None |
| A0A1W1D4X0 | 475-947 | None |
| A0A410Q1L1 | 269-751 | None |
| A0A6J7IL25 | 207-632 | None |
| A0A6P3Z2M9 | 42-458 | None |
| A0A124FRK0 | 389-824 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.