DPCstruct | MC4118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 144 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7J3Z7 | 1-107 | MECHDPHADTMTVDDCLLCHKPHMPVEVTYAENIPSFFCSSCHEIEGKGLAKSTTKHHELGCAYCHRNKHKAAIECGTCHGEPHSFD… |
| A0A1E7IUS0 | 3-132 | AHPSEHAGLDCKECHSEHGESTPCMECHESHAEGMNLQACLSCHKPHGPTEVKYDDSVPVDYCTCCHENEGSNLAKSSKAHHELGCV… |
| A0A831LS48 | 123-275 | None |
| A0A842Y636 | 132-277 | None |
| Q1JWC3 | 279-430 | None |
| A0A1M6B3N5 | 995-1145 | None |
| A0A7C0VPE3 | 26-170 | None |
| A0A831XWB6 | 91-241 | None |
| A0A353XM86 | 175-322 | None |
| A0A1E7HDC1 | 12-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.