DPCstruct | MC41176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 65.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2DZX4 | 19-94 | MILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRTTPGDSRVGDDYNLPHWINHSFYTSKSQNSCSSFTPRIKL |
| A0A821S801 | 1-75 | MTKQRVLDNGIGSDLVCLGEQPLFAVPLFKFFKENPNTADDYQIPHWMNLSYYHRSTAPSCFSSYIPRLPFDKNR |
| A0A1I7WUY3 | 39-109 | None |
| W2T8P7 | 404-476 | None |
| A0A821JAS8 | 149-226 | None |
| A0A0C2DHB3 | 1-84 | None |
| A0A0R3PWQ8 | 268-349 | None |
| A0A183G9A0 | 93-178 | None |
| A0A818Y5B3 | 1-74 | None |
| A0A815AK39 | 149-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.