DPCstruct | MC41175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821RE96 | 1-102 | IDVKVTSEVTLENVELNIADRDNAAQVKTYKLTYPNALSNNLEIDYHQKLIIKFQIKNKQTDEFIRVQQTFLRITNKKSNKEIIYLA… |
| A0A183HVB2 | 73-186 | GSQDKRLVGTNGASLMMRILVKVRIEDIAVAVFDRELLKPSSSISVKQNAKIGKILEADIHNKMEIRFKVKEAKTDEAVLVHQAFVI… |
| G3WXP9 | 601-697 | None |
| A0A0C9UBW3 | 8-111 | None |
| A0A6V8HAF9 | 13-109 | None |
| A0A812EWF6 | 300-390 | None |
| A0A4S2LU91 | 401-505 | None |
| A0A833VDK9 | 248-350 | None |
| A0A6P5MQM8 | 16-119 | None |
| A0A453G9Z7 | 281-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.