DPCstruct | MC41171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 162 ± 26 aa |
| Standard deviation of domain lengths | 25.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 77.50 |
| Assigned Pfam label(s) | CL0525- PF14260- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821Q928 | 1-134 | DPVYVLDNNVPIDTKYYLEQQLSKPLLRIFEPILGDAKAESILLHGEHTSVKTVVTSKVGGLASFITKKDKCIGCKTVLQEQGTALC… |
| A0A4S8LR00 | 168-309 | KQAHVELAKRMKQRDAGSAPALGDRVAYVIIKGVKGGLMKFAVKTVTCLGCKTPLRANNSLNKDGAVCRNCRPRMAELYQKQVATAS… |
| A0A0C9TCP4 | 82-277 | None |
| A0A2N9GRP6 | 410-577 | None |
| D5AEH5 | 69-226 | None |
| A0A2G9RWR8 | 388-562 | None |
| A0A0L0T1L7 | 776-957 | None |
| A0A812VK83 | 20-178 | None |
| A0A453HJ01 | 1-114 | None |
| A0A3P7P6P3 | 140-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.